SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000956 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000956
Domain Number 1 Region: 103-201
Classification Level Classification E-value
Superfamily LCCL domain 1.44e-28
Family LCCL domain 0.0013
Further Details:      
 
Domain Number 2 Region: 205-309
Classification Level Classification E-value
Superfamily LCCL domain 7.19e-28
Family LCCL domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000956   Gene: ENSCJAG00000000549   Transcript: ENSCJAT00000001016
Sequence length 314
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:27390658:27424245:1 gene:ENSCJAG00000000549 transcript:ENSCJAT00000001016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMNATHIVHSGVLVLYVRIIHRGNWWGHAPYKHGQPCSACPPSFGGGCRENLCYKEGSD
NYYAPQEEETNEIEGQQSEVHDTHVHTRSDNSNRNEVISTQQMSQFVSCEVKLRDQCKGT
TCNRYECPAGCLSSTAKVIGSVHYDMHSSICRAAIHYGIIDNDGGWVDITRQGRKLYFMY
SSRNGVESVSKYQSANSFTVSKVTVQAVTCETTVEQLCPFHKPASHCPRVYCPRDCMQAN
PHYARVIGTRFYSDVSSICRAAVHAGVVRNHGGYVDVMPVDKRKAYKASFQNGISSESLQ
NPTGGKAFRVFAVM
Download sequence
Identical sequences F6RQX6
XP_008981049.1.60252 ENSCJAP00000000956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]