SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001347 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001347
Domain Number 1 Region: 84-154
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.86e-21
Family Ribosomal S5 protein, N-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 166-239
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.31e-20
Family Translational machinery components 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001347   Gene: ENSCJAG00000000791   Transcript: ENSCJAT00000001430
Sequence length 278
Comment pep:novel chromosome:C_jacchus3.2.1:14:63895005:63896361:-1 gene:ENSCJAG00000000791 transcript:ENSCJAT00000001430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDGIGAARGEGRGGGPWGPGMGNLGGFCGGIRGPGQGRMGPGEDKEGMPITKLGHLVKG
MKIKSLENHICFFSLPIKESEIIDFFLGSLKDEVLKIMRVQKQTHAGQRTRFKAFVATGD
YNGYVGLGVKCSKEVATAIRRAIILAKLSTVPVCRGYWGNNIGKPHTVLCRVTGHCGSVL
VCLIPKPRGTGINSTPVPKKLQVMAGINDCYTSAKGCTAILGNFAKATFEAISKTYSYLP
DLWRETVFTKSPYQEFTDHKTHTRDSVQRTQAPAVATT
Download sequence
Identical sequences F7C0E7
ENSCJAP00000001347 ENSCJAP00000001347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]