SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001541 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001541
Domain Number 1 Region: 223-471
Classification Level Classification E-value
Superfamily SIS domain 2e-18
Family mono-SIS domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001541   Gene: ENSCJAG00000000899   Transcript: ENSCJAT00000001637
Sequence length 568
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:80920115:80945184:-1 gene:ENSCJAG00000000899 transcript:ENSCJAT00000001637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATKRFQHVIETPEPGQWELSGYEAAVPITEKSNPLTWDLDKADAEKIVRLLLGLNCKN
VGRWEGILFQNNCINQSATKRGGLDMGPGLAGRLPSFLSILQLSGSKNSETHKEKRILTS
KSLQFSAPFVAGQMDYCMNNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKMQ
QKQKAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDRGIAASQRCLLEILR
TFERAHQVTYSQGPKIATLMKHVSASLEKKGHVYLVGWQTLGIIAIMDGVECIHTFGADF
QDVRGFLIGDHSDMFNQKAEITNQGPQFSFSQEDFLTSILPSLMEIDTVVFIFTLDDNLM
EVQTIVEQVKDKTSNIQALAHSTVGQSLPIPLKKLFPSIISITWPLLFFDYEGNFIQKFQ
RELSTKWVLNTVSTGAHVLLGKILQNHMLDLRISNSKLFWRALAMLQRFSGQSKARCIES
LLQAIHFPQPLSDDIRAAPISCHVQVAHEKEQVIPIALLSLLFRCSITEAQTHLAAAPSV
CEAVRSALAGPGQKRTADPLEILEPAVQ
Download sequence
Identical sequences F6ZY33
ENSCJAP00000001541 ENSCJAP00000001541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]