SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001908 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001908
Domain Number 1 Region: 16-94
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000042
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000001908
Domain Number - Region: 185-232
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0983
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001908   Gene: ENSCJAG00000001102   Transcript: ENSCJAT00000002022
Sequence length 358
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:81138843:81161761:-1 gene:ENSCJAG00000001102 transcript:ENSCJAT00000002022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNP
LWQSRGSTTVSSGGRFRCPSCRHEVVLGSYHYHTTRFCIKQNFQIQLRAHRSRGKNRTSE
QHEGTEKKNKTKQNVYLWERRGLSATLAGVRGVALDQVPVLSADLFVCQSELSDGIAMLV
AGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQKFESLCAVLEERKGELLQALAREQEEK
LQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAGRP
EPGYESMEPFTVSVEHVAEMLRTIDFQPGTSGEEEDEEVALDGDEGTAGPEEGRPDGP
Download sequence
Identical sequences F6YC50
ENSCJAP00000001908 ENSCJAP00000001903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]