SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002054 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002054
Domain Number 1 Region: 28-73
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 3.66e-18
Family Assembly domain of cartilage oligomeric matrix protein 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002054   Gene: ENSCJAG00000001175   Transcript: ENSCJAT00000002172
Sequence length 128
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:64231894:64240808:-1 gene:ENSCJAG00000001175 transcript:ENSCJAT00000002172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPATACVLLFTMAALGVSGQGQIPSGSDLGPQMLRELRETNAALQDVRELLRQQVREIT
FLKNTVMECDACGERQCSAHPCPRPLYQHQPGIPLRGLPAGVQRPHPRGRGAGFRQDQQA
GLHGHQRV
Download sequence
Identical sequences F7I0A4
ENSCJAP00000002054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]