SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002180 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002180
Domain Number 1 Region: 17-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.06e-91
Family Calponin-homology domain, CH-domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 755-876
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-35
Family Pleckstrin-homology domain (PH domain) 0.00000217
Further Details:      
 
Domain Number 3 Region: 297-419
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-34
Family Spectrin repeat 0.0000609
Further Details:      
 
Domain Number 4 Region: 429-527
Classification Level Classification E-value
Superfamily Spectrin repeat 4.92e-20
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 5 Region: 532-622
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000119
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002180   Gene: ENSCJAG00000001228   Transcript: ENSCJAT00000002301
Sequence length 934
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:122430440:122466448:-1 gene:ENSCJAG00000001228 transcript:ENSCJAT00000002301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFERSRIKALADEREAVQK
KTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRIHCLENVD
KALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKD
ALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNA
FNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHA
MEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFT
EKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQ
EKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGR
VQAVDAVAAELAAEHYHDIKRISARQHNVARLWDFLRQMVAARRERLLLNLELQKVLQDL
LYLMDWMEDMKGRLQSQDLGKHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCNP
GKDYRPCDPQLVSGRVTKLAELEEREKERKRKREEEERRKRPPAPEPTASVPPGNLVGSH
TAPDTTWDGTQPRPPPSTQAPSVNGVCTDAESSQPLLGQQRLEQSSFPEGPGPGPGDEAN
GPRGERQTRTRGSAPPTIPQSRSTESAHAATLPPRAPELSAQEQMEGVLCRKQEMEAFGK
KAANRSWQNVYCVLRRGSLGFYKDAKAASAGVPYHGEVPVSLARAQGSVASDYRKRKHVF
KLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVVPSAPRGMTRAMTMP
PVSPVGAEGPVVLRSKDGREREREKRFSFFKKNK
Download sequence
Identical sequences F7IBY5
ENSCJAP00000002180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]