SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002218 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002218
Domain Number 1 Region: 17-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-90
Family Calponin-homology domain, CH-domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 2211-2332
Classification Level Classification E-value
Superfamily PH domain-like 5.36e-35
Family Pleckstrin-homology domain (PH domain) 0.00000217
Further Details:      
 
Domain Number 3 Region: 297-419
Classification Level Classification E-value
Superfamily Spectrin repeat 9.81e-34
Family Spectrin repeat 0.0000609
Further Details:      
 
Domain Number 4 Region: 907-1062
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-30
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 1644-1797
Classification Level Classification E-value
Superfamily Spectrin repeat 6.26e-27
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1014-1168
Classification Level Classification E-value
Superfamily Spectrin repeat 7.44e-27
Family Spectrin repeat 0.0000352
Further Details:      
 
Domain Number 7 Region: 1226-1379
Classification Level Classification E-value
Superfamily Spectrin repeat 6.77e-26
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 8 Region: 1855-2010
Classification Level Classification E-value
Superfamily Spectrin repeat 4.85e-25
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 9 Region: 697-813
Classification Level Classification E-value
Superfamily Spectrin repeat 6.17e-25
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 10 Region: 819-946
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-21
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 11 Region: 532-640
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-20
Family Spectrin repeat 0.00077
Further Details:      
 
Domain Number 12 Region: 1482-1594
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-20
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 13 Region: 429-527
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-19
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 14 Region: 1381-1493
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-18
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 15 Region: 2015-2075
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000187
Family Spectrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002218   Gene: ENSCJAG00000001228   Transcript: ENSCJAT00000002339
Sequence length 2390
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:122429860:122466582:-1 gene:ENSCJAG00000001228 transcript:ENSCJAT00000002339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFERSRIKALADEREAVQK
KTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRIHCLENVD
KALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKD
ALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNA
FNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHA
MEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFT
EKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQ
EKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGR
VQAVDAVAAELAAEHYHDIKRISARQHNVARLWDFLRQMVAARRERLLLNLELQKVLQDL
LYLMDWMEDMKGRLQSQDLGKHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCNP
GKDYRPCDPQLVSGRVTKLEQSYEALCELAAARRARLEESRRLWRFLWEVGEAEAWVREQ
QHLLASADTGRDLTGVLRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASA
RAAELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEF
STQALARQHRALEEEIRGHRPTLEALREQAVALPPALSHTPEVQGRVPSLERHYDELQAR
ARERALALEAALTLYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPE
MNALAVQITAVNDTARQLLKANPPGKDRIINTQEQLNHRWQQFRSLADGKKAALTSALSI
QNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAARVGELTR
EANALAAGHPAQAAAINARLGEVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAW
LGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRALGEEVTRDQADPQC
LFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEM
PGTLQAADAAIKKLEDFMSTMDANGERIRGLLEAGRQLVSEGNIHADKIQEKADSIERRH
KKNQDAAQQFLGRLRDNREQQHFLQDCHELRLWIDEKMLTAQDVSYDEARNLHTKWQKHQ
AFMAELAANKDWLDKVDKEGRELTLQKPELKALVSEKLGDLHRRWDELETTTQAKARSLF
DANRAELFAQSCCALESWLESLQAQLHSDDYGKDLTSVNILLKKQQMLEWEMAVREKEVE
AIQAQAKALAQEDQGAGEVERTSRAVEEKFRALCQPMRERCQRLQASREQHQFHRDVEDE
ILWVTERLPMASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADLRERQHVLGAAAAG
PELAELQEMWKRLGHELELRGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDE
LSAQAEVKKHQVLEQALADYAQTIHQLAASSQDMIDHEHPESTRISIRQAQVDKLYAGLK
ELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFS
RDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAA
YELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSAQVQQVQ
DDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELM
LWMDGVNLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCINMGKELLARSHYA
AEEISEKLSQLQARRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAE
LGCTVDEVESLIKRHEAFQKSAVAWEERFSALEKLTALEEREKERKRKREEEERRKRPPA
PEPTASVPPGNLVGSHTAPDTTWDGTQPRPPPSTQAPSVNGVCTDAESSQPLLGQQRLEQ
SSFPEGPGPGPGDEANGPRGERQTRTRGSAPPTIPQSRSTESAHAATLPPRAPELSAQEQ
MEGVLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGVPYHGEVPVSLAR
AQGSVASDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEP
VVPSAPRGMTRAMTMPPVSPVGAEGPVVLRSKDGREREREKRFSFFKKNK
Download sequence
Identical sequences F7HXR3
XP_009006783.1.60252 XP_009006784.1.60252 ENSCJAP00000002218 ENSCJAP00000002180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]