SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002294 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002294
Domain Number 1 Region: 329-604
Classification Level Classification E-value
Superfamily RNI-like 8.44e-38
Family Cyclin A/CDK2-associated p19, Skp2 0.0075
Further Details:      
 
Domain Number 2 Region: 265-334
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000068
Family F-box domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002294   Gene: ENSCJAG00000001288   Transcript: ENSCJAT00000002422
Sequence length 621
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:98035273:98103554:-1 gene:ENSCJAG00000001288 transcript:ENSCJAT00000002422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPVFPMLTVLTMFYYICLRRRARTATRGEMMNSHRTIESNSRTSPLNAEVVQYAKEVVD
FSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSASLPFKRTPPN
FQSQDYVELTFEQQVYPTAVYVLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERP
TKVNASQARQFKPCIKQINFPTNLIRLEVNSSLLDYYTELDAVVLHGVKDKPVLSLKTSL
IDMNDIEDDAYEEKNGCGMDNLNKKFSSAVLREGPNNGYFDKLPYELIQLILNHLTLPDL
CRLAQTCKLLSQHCCDPLQYIHLNLQPYWAKLNDTSLEFLQARCTLVQWLNLSWTGNRGF
ISVTGFSRFLKVCGSELVRLELSCSHFLNETCLEVISEMCPNLQALNLSSCDKLPPQAFN
HISKLCSLKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCKK
LRTLDLWRCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLARQLPNLQKLFL
TANRSVCDTDIEELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDN
RAVLELNASFPKVFIKKSFTQ
Download sequence
Identical sequences F7EHS3
XP_002746898.1.60252 ENSCJAP00000002294 ENSCJAP00000002294 ENSCJAP00000050714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]