SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002378 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002378
Domain Number 1 Region: 14-244
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.85e-88
Family Calponin-homology domain, CH-domain 0.0000192
Further Details:      
 
Domain Number 2 Region: 262-384
Classification Level Classification E-value
Superfamily Spectrin repeat 1.94e-32
Family Spectrin repeat 0.000000775
Further Details:      
 
Domain Number 3 Region: 498-619
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-32
Family Spectrin repeat 0.00000436
Further Details:      
 
Domain Number 4 Region: 379-494
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-24
Family Spectrin repeat 0.00000178
Further Details:      
 
Domain Number 5 Region: 727-854
Classification Level Classification E-value
Superfamily EF-hand 8.68e-22
Family EF-hand modules in multidomain proteins 0.062
Further Details:      
 
Domain Number 6 Region: 623-734
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-19
Family Spectrin repeat 0.00000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002378   Gene: ENSCJAG00000001334   Transcript: ENSCJAT00000002507
Sequence length 882
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:122279384:122294022:1 gene:ENSCJAG00000001334 transcript:ENSCJAT00000002507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGGGEYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKL
MLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLG
MIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHR
HRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCF
YHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTVPWLENRVGEPS
MSAMQRKLEDFRDYRRLHKPPRVQEKCQLEINFNTLQTKLRLSHRPAFMPSEGKLVSDIA
NAWRGLEQVEKGYEDWLLSEIRRLQRLQHLAEKFRQKASLHEAWTRGKEEMLSQRDYDSA
SLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDYHEAASVNSRCQAICDQWDN
LGTLTQKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLDGAVEDLQDVWLVHSVEETQ
SLLTAHDQFKATLPEADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWD
MVRKLVPSRDQTLQEELARQQVNERLRRQFAAQANAIGPWIQAKVEEVGRLAAGLAGSLE
EQMAGLRQQEQNIINYKTNIDRLEGDHQLLQESLVFDNKHTVYGMEHIRVGWEQLLTSIA
RTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKRNGMMEPDDFRACLISMGYDLGEV
EFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTAEQVVASFKILAGDKSYITPEELRR
ELPAEQAEYCIRRMVPYKGSGAPAGALDYVAFSSALYGESDL
Download sequence
Identical sequences F7IE32
ENSCJAP00000002378 ENSCJAP00000002378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]