SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002385 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002385
Domain Number 1 Region: 103-224
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-32
Family Spectrin repeat 0.00000436
Further Details:      
 
Domain Number 2 Region: 332-459
Classification Level Classification E-value
Superfamily EF-hand 3.65e-22
Family EF-hand modules in multidomain proteins 0.052
Further Details:      
 
Domain Number 3 Region: 12-99
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-19
Family Spectrin repeat 0.00000932
Further Details:      
 
Domain Number 4 Region: 228-339
Classification Level Classification E-value
Superfamily Spectrin repeat 2.34e-19
Family Spectrin repeat 0.00000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002385   Gene: ENSCJAG00000001334   Transcript: ENSCJAT00000002514
Sequence length 487
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:122289191:122294022:1 gene:ENSCJAG00000001334 transcript:ENSCJAT00000002514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNPQDRGRCSAGKEEMLSQRDYDSASLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQE
LNELDYHEAASVNSRCQAICDQWDNLGTLTQKRRDALERMEKLLETIDQLQLEFARRAAP
FNNWLDGAVEDLQDVWLVHSVEETQSLLTAHDQFKATLPEADRERGAIMGIQGEIQKICQ
TYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSRDQTLQEELARQQVNERLRRQFAAQAN
AIGPWIQAKVEEVGRLAAGLAGSLEEQMAGLRQQEQNIINYKTNIDRLEGDHQLLQESLV
FDNKHTVYGMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDR
KRNGMMEPDDFRACLISMGYDLGEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDT
AEQVVASFKILAGDKSYITPEELRRELPAEQAEYCIRRMVPYKGSGAPAGALDYVAFSSA
LYGESDL
Download sequence
Identical sequences F7IBT1
ENSCJAP00000002385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]