SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002658 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002658
Domain Number 1 Region: 216-296
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000103
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 81-151
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000655
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000002658
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00494
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 
Domain Number - Region: 451-549
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0798
Family Apolipoprotein A-I 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002658   Gene: ENSCJAG00000001482   Transcript: ENSCJAT00000002806
Sequence length 800
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:122147119:122152738:1 gene:ENSCJAG00000001482 transcript:ENSCJAT00000002806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFSGGT
PLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLTLPSALDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLEPRPRPGPGPGPASLFLAMFQSRHAKDLALLDISESVLIYLGFER
SELLCKSWYGLLHPEDLAHASAQHYRLLAESGDIQAEMVVRLQAKTGGWAWIYCLLYSEG
PEGPITANNYPISDMEAWSLRQQLNSEDNQAAYVLGTPTMLPSFPENILSQEQCSSTNPL
FTAALGAPRSTSFPSAPELSVVSASEELPRPSKELDFSYLAFPSGPEPSLQAELSKDLVC
TPPYTPHQPGGCAFLFSLHEPFQTHLPAPSSTLQEQLTPSTATFSDQLTPSSATFPDPLT
SPLQGQLTETSARSYEDQLTPCTSTFPDQLLPSTATFPEPVGSPAHEQLTPPSTAFQAHL
DSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSVDV
PLVPEGLLTPEASPVKQSFFHYSEKEQNEIDRLIQQISQLAQGMDRPFSAEAGTGGLEPL
GGLEPLDSNLSLSGAGPPVLSLDLKPWKCQELDFLADPDNMFLEETPVEDIFMDLSTPDP
NEEWGSGDPEAEGPGGAPSPCNNLSPEDHSFLEDLATYETAFETGVSAFPYDGFTDELHQ
LQSQVQDSFHEDGSGGEPTF
Download sequence
Identical sequences F7I266
ENSCJAP00000002658 ENSCJAP00000002658 XP_002755607.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]