SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002682 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002682
Domain Number 1 Region: 102-179
Classification Level Classification E-value
Superfamily L domain-like 7.65e-16
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002682   Gene: ENSCJAG00000001492   Transcript: ENSCJAT00000002831
Sequence length 190
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:33511622:33657638:-1 gene:ENSCJAG00000001492 transcript:ENSCJAT00000002831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGPVFFYILIIGKYFSHAGGQDVKCSLGYFPCGNVTKCLPQLLHCNGVDDCGNQADED
DCGDNNGWSLQFDKYFANYFKMTSPHPFEAEKPECLVGSVPLQCRCQGLELDCDETNLRA
VPSVSSNVTVMSLQWNLIRKLPPDCFKNYHDLRKLYLQNNKITSISVYAFRGLNSLTKLS
KAVKDGSEKQ
Download sequence
Identical sequences F7HZQ7
ENSCJAP00000002682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]