SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002869 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002869
Domain Number 1 Region: 30-96,140-219
Classification Level Classification E-value
Superfamily PAZ domain 4.16e-22
Family PAZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002869   Gene: ENSCJAG00000031580   Transcript: ENSCJAT00000003032
Sequence length 229
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:70289907:70356984:1 gene:ENSCJAG00000031580 transcript:ENSCJAT00000003032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPR
RVNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRP
FKVSIKFVSRVSWHLLHEVLTGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGR
SFFSAPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDERDLWQQCGK
Download sequence
Identical sequences A0A2K5F5W5 A0A2K5RWR6 A0A2K6U662 F7I920
ENSCJAP00000002869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]