SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002933 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002933
Domain Number 1 Region: 445-469
Classification Level Classification E-value
Superfamily Notch domain 0.0000131
Family Notch domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002933   Gene: ENSCJAG00000001633   Transcript: ENSCJAT00000003100
Sequence length 488
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:91927224:91988023:-1 gene:ENSCJAG00000001633 transcript:ENSCJAT00000003100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKLLQRQTYTCLSHRYGLYVCFVGVVVTIVSAFQFGEVVLEWSRDQYHVLFDSYRDNI
AGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQMEEEQKAMREILGKNTTEPTK
KSEKQLECLLTHCIKVPMLVLDPSLPANITLKDLPSLYPSFHSASDMFNVAKPKNPSTNV
SVVVFDSTKDVEDAHSGLFKGNNRQTVWRGYLTTDKEVPGLVLMQDLAFLSGFPPTFKET
NQLKTKLPENLSSKIKLLQLYSEASVALLKLNNPKDFQELNKQTKKNMTIDGKELTISPA
YLLWDLSAISQSKQDEDISASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNL
DNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDF
YSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGKDVLNCNLFI
FYFLLKVY
Download sequence
Identical sequences F7HX99
ENSCJAP00000002933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]