SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003006 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003006
Domain Number 1 Region: 78-282
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.28e-55
Family SPRY domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 36-86
Classification Level Classification E-value
Superfamily F-box domain 0.000000000024
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003006   Gene: ENSCJAG00000001685   Transcript: ENSCJAT00000003175
Sequence length 285
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:18386858:18405853:-1 gene:ENSCJAG00000001685 transcript:ENSCJAT00000003175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAPGAGAASGGAGCSGSGAGAGAGAGSGSGAGGRLPSRVLELVFSYLELSELRSCAL
VCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSR
NVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPMQ
CQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDMEDKTL
AFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYLGKPLDG
Download sequence
Identical sequences F7GQ67
ENSCJAP00000003006 XP_017820304.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]