SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003067 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003067
Domain Number 1 Region: 64-183,259-364
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.4e-64
Family FabD-like 0.0001
Further Details:      
 
Domain Number 2 Region: 210-266
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000107
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003067   Gene: ENSCJAG00000001717   Transcript: ENSCJAT00000003236
Sequence length 390
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:203112117:203121843:-1 gene:ENSCJAG00000001717 transcript:ENSCJAT00000003236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRFVRAAWARGLGPSCCRGASSFPVPPPDAQGVAELLRDATGAEEEAPSTATERRMPG
QYSVLLFPGQGSQVVGMGRGLLSYPRVRELYAAAHRVLGYDLLELSLHGPQEDLDRTVHC
QPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFSEGLYAVKIRAE
AMQEASDAVPSGMLSILGQPQSKFNLACLEAREHCKSLGIENPVCEVSNYLFPDCRVISG
HLEALRFLRKNSSKYHFRRTRMLPVSGAFHTRLMEPAVEPLMQVLKAIDVKKPLVSVYSN
VHGHRYMHPTHIQKLLAQQVVSPVKWEQTMHAIYKRKKGSEFPRTFEVGPGQQLGAILKS
CNLQAWKSYSPVDVLQTLEHIDPDPEESPR
Download sequence
Identical sequences F7G6W7
ENSCJAP00000003067 XP_002743873.1.60252 ENSCJAP00000003067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]