SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003201 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003201
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 1.26e-55
Family C-type lysozyme 0.000000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003201   Gene: ENSCJAG00000001788   Transcript: ENSCJAT00000003379
Sequence length 148
Comment pep:known chromosome:C_jacchus3.2.1:9:58823136:58828531:1 gene:ENSCJAG00000001788 transcript:ENSCJAT00000003379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLIILGLVLLSVMVQGKVFERCELARTLKRFGLDGYRGISLANWMCLAKWESDYNTRA
TNYNPGDQSTDYGIFQINSHYWCNNGRTPGAVNACHISCNALLQDDITEAVACAKRVVRD
PQGIRAWVAWKAHCQNRDVSQYVQGCGV
Download sequence
Identical sequences P79158 U3FDD0
XP_002752792.1.60252 ENSCJAP00000003201 ENSCJAP00000003201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]