SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003280 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003280
Domain Number 1 Region: 1578-1818
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.28e-52
Family Ankyrin repeat 0.00000094
Further Details:      
 
Domain Number 2 Region: 473-592
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000502
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 3 Region: 341-478
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 925-1049
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000033
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 5 Region: 192-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000122
Family EGF-type module 0.008
Further Details:      
 
Domain Number 6 Region: 587-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 766-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 8 Region: 275-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000382
Family EGF-type module 0.017
Further Details:      
 
Domain Number 9 Region: 156-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000516
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 1045-1089
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000657
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 11 Region: 234-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000709
Family EGF-type module 0.023
Further Details:      
 
Domain Number 12 Region: 896-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000935
Family EGF-type module 0.015
Further Details:      
 
Domain Number 13 Region: 676-801
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000127
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number 14 Region: 1251-1282
Classification Level Classification E-value
Superfamily Notch domain 0.000000262
Family Notch domain 0.0022
Further Details:      
 
Domain Number 15 Region: 808-932
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000785
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 16 Region: 29-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000082
Family EGF-type module 0.031
Further Details:      
 
Domain Number 17 Region: 1214-1244
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 18 Region: 64-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000188
Family EGF-type module 0.018
Further Details:      
 
Domain Number 19 Region: 118-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000021
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000003280
Domain Number - Region: 1173-1202
Classification Level Classification E-value
Superfamily Notch domain 0.00314
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 1132-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00522
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 319-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0112
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 1087-1124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0162
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 624-655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0321
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003280   Gene: ENSCJAG00000001787   Transcript: ENSCJAT00000003462
Sequence length 2000
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:32773679:32801380:-1 gene:ENSCJAG00000001787 transcript:ENSCJAT00000003462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSPSLLLLLLLLLRHSVVITRGLQCGSLPEPCANGGTCLSLSEGQGTCQCAPGFLGETC
QFPDPCQNTQLCQNGGSCQALLPAPLGPPSAPTPLAPSFSCTCLLGFTGERCQARLEDPC
PPSFCSKRGRCHIQASGHPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQCRC
PPGFEGHACERDVNECFQDPGPCPNGTTCHNTLGSFQCLCPVGREGPHCELRAGPCPPRG
CLNGGTCQLMPVKDSTFHLCLCPPGFIGLDCEVNPDNCVSHQCQNGGTCQDGLDTYTCLC
PETWTGWDCSEDLDECEAQGPPRCRNGGTCQNSAGSFHCVCVSGWGGTGCEENLDDCIAA
TCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGEAQCSTNPLTGSTLCLCQP
GYSGPTCHQDLDECLMAQEGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCETDYNECLSQ
PCHPASTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNNADCHDLLNGFQCICPPG
FTGTRCEEDIDECRSSPCANGGQCQDHPGAFHCKCLPGFEGPRCQTEVNECLSDPCPVGA
SCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKEQKDKANCLCPDGSPGCAPPE
DNCTCHHGHCQRSSCVCDVGWTGPGCETELGGCVSAPCAHGGTCYPQPSGYNCTCPADYT
GPTCSEEITACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQSSTDHCVSAPCFNGGTC
VNRPGAFSCVCAVGFQGPRCEGRIRPSCADSPCRNRATCQDSPQGPRCLCSTGYTGGSCQ
TLMDLCAQKPCPRNSHCLQTGPSFYCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCQ
NGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQHGATCMAQPNGYLCQCAPGYKG
QNCSKEPDACQSQPCHNHGTCTPQPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAA
CHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICQCPKGFEGP
TCSHRAPSCGLHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLY
NGSCTETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGGD
CSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDH
FHNGHCEKGCNTAACGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARRLSLT
LRVGLWVRKDRDGRDMVYPYPGARAEEALGGTRDPSNQERAVPQMQPLGKETDSLSAGFV
VVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAAHSHAGTTNPA
NQLPWPVLCSPVAGVLLLALGALLVLQLIRRRRREHGALWLPPGFTRQPRTQSAPHRRRP
PLGEDSIGLKALKPEAEVDEDGVVMCSGPEEGEEVGQAEETGPPSKCQLWPLSGGCGELP
QAMLTPPQESEMEAPDLDTRGPDGVTTLMSAVCCGEVESRTFQGAWLGCPEPWEPLLDGG
SCPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAREVC
QLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAA
VNNARAARSLLQGGADKDAQDSREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAGLAP
ADVARQRNHWDLLTLLEGAGPLEARHKATPAREAGPSPRARMASGSVSPHGGGALPRCRT
LSAGAGQRRGGACLQARTSSVDLTARGGGAYSHCRSLSGGGVGGGPPPRGRRFSAGMRGP
RPNPAIKRGRFGVAAGCGGRVSADDWPCDWVALRPCGSASNIPIPPPCLTPSPERGSPQV
DCGPPAHQEMPINPGGEGKK
Download sequence
Identical sequences F7G6G3
ENSCJAP00000003202 ENSCJAP00000003280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]