SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003288 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003288
Domain Number 1 Region: 36-310
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.96e-70
Family Pancreatic carboxypeptidases 0.000000000995
Further Details:      
 
Domain Number 2 Region: 313-407
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.16e-22
Family Carboxypeptidase regulatory domain 0.00000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003288   Gene: ENSCJAG00000001828   Transcript: ENSCJAT00000003470
Sequence length 446
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:58270644:58341033:-1 gene:ENSCJAG00000001828 transcript:ENSCJAT00000003470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSFIVLQVMIPSQSTIDYNLTLYNLNKECVKHGDVSHKNLSHREIVKRSGKGRHLWVLVV
GRSPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDHFVTSDGKDPEITNLINSTRIHIM
PSMNPDGFEAVRKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVSRQPETVAVMKWLNTET
FVLSANLHGGALVASYPFDNGVPATGALYSRSLTPDDDVFQYLAHTYASRNPNMKKGDEC
KSKMNFPNGVTNGYSWYPLQGGMQDYNYIWGQCFEITLELSCCKYPREEKLPSFWNNNKA
SLIEYMKQVHLAGVKGQVFDQNGNPLPHVIVEVQDRKHICPYRTNKYGEYYLLLLPGSYI
INVTVPGHEPYLTKVIIPEKSQNFSALKKDILLPFRGKLDSIPASNPSCPMIPLYRNLPS
HSAATKPSLFLFLVTLLHIFFKQSKM
Download sequence
Identical sequences F7G692
ENSCJAP00000003288 ENSCJAP00000003294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]