SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003294 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003294
Domain Number 1 Region: 14-313
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.45e-79
Family Pancreatic carboxypeptidases 0.000000000366
Further Details:      
 
Domain Number 2 Region: 314-408
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.16e-22
Family Carboxypeptidase regulatory domain 0.00000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003294   Gene: ENSCJAG00000001828   Transcript: ENSCJAT00000003476
Sequence length 444
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:58270380:58383969:-1 gene:ENSCJAG00000001828 transcript:ENSCJAT00000003476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPCLWLKLLLPLVAALDFNYHHQEGMEAFLKNVAQNYSSITHLHSIGKSVKGRHLWVL
VVGRSPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDHFVTSDGKDPEITNLINSTRIH
IMPSMNPDGFEAVRKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVSRQPETVAVMKWLNT
ETFVLSANLHGGALVASYPFDNGVPATGALYSRSLTPDDDVFQYLAHTYASRNPNMKKGD
ECKSKMNFPNGVTNGYSWYPLQGGMQDYNYIWGQCFEITLELSCCKYPREEKLPSFWNNN
KASLIEYMKQVHLGVKGQVFDQNGNPLPHVIVEVQDRKHICPYRTNKYGEYYLLLLPGSY
IINVTVPGHEPYLTKVIIPEKSQNFSALKKDILLPFRGKLDSIPASNPSCPMIPLYRNLP
SHSAATKPSLFLFLVTLLHIFFKQ
Download sequence
Identical sequences F7EN47
ENSCJAP00000003294 ENSCJAP00000003301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]