SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003306 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003306
Domain Number 1 Region: 1145-1384
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.74e-50
Family Ankyrin repeat 0.00000123
Further Details:      
 
Domain Number 2 Region: 26-157
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000382
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 3 Region: 152-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000111
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 490-607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000146
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 5 Region: 331-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000148
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 6 Region: 241-366
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000565
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number 7 Region: 460-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000129
Family EGF-type module 0.022
Further Details:      
 
Domain Number 8 Region: 818-849
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0022
Further Details:      
 
Domain Number 9 Region: 372-497
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000188
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 781-811
Classification Level Classification E-value
Superfamily Notch domain 0.0000085
Family Notch domain 0.0065
Further Details:      
 
Domain Number 11 Region: 610-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 12 Region: 5-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family EGF-type module 0.007
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000003306
Domain Number - Region: 740-769
Classification Level Classification E-value
Superfamily Notch domain 0.00235
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 654-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00258
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 699-737
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0042
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 189-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.022
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003306   Gene: ENSCJAG00000001787   Transcript: ENSCJAT00000003489
Sequence length 1566
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:32773862:32801337:-1 gene:ENSCJAG00000001787 transcript:ENSCJAT00000003489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQEGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCETDYNECLSQPCHPASTCLDLLATF
HCLCPPGLEGQLCEVETNECASAPCLNNADCHDLLNGFQCICPPGFTGTRCEEDIDECRS
SPCANGGQCQDHPGAFHCKCLPGFEGPRCQTEVNECLSDPCPVGASCLDLPGAFFCLCPS
GFTGQLCEVPLCAPNLCQPKQICKEQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQRSSC
VCDVGWTGPGCETELGGCVSAPCAHGGTCYPQPSGYNCTCPADYTGPTCSEEITACHSGP
CLNGGSCNPSPGGYYCTCPPSHTGPQCQSSTDHCVSAPCFNGGTCVNRPGAFSCVCAVGF
QGPRCEGRIRPSCADSPCRNRATCQDSPQGPRCLCSTGYTGGSCQTLMDLCAQKPCPRNS
HCLQTGPSFYCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCQNGGLCVDSGPSYFCH
CPPGFQGSLCQDHVNPCESRPCQHGATCMAQPNGYLCQCAPGYKGQNCSKEPDACQSQPC
HNHGTCTPQPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLANAFYCQCLPG
HTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICQCPKAIGFEGPTCSHRAPSCGLHH
CHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLYNGSCTETTGLGGP
GFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGGDCSLGVPDPWKGCP
SHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDHFHNGHCEKGCNTA
ACGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARRLSLTLRVGLWVRKDRDG
RDMVYPYPGARAEEALGGTRDPSNQERAVPQMQPLGKETDSLSAGFVVVMGVDLSRCGPD
HPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAAHSHAGTTNPANQLPWPVLCSPVA
GVLLLALGALLVLQLIRRRRREHGALWLPPGFTRQPRTQSAPHRRRPPLGEDSIGLKALK
PEAEVDEDGVVMCSGPEEGEEVGQAEETGPPSKCQLWPLSGGCGELPQAMLTPPQESEME
APDLDTRGPDGVTTLMSAVCCGEVESRTFQGAWLGCPEPWEPLLDGGSCPQAHTVGTGET
PLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAREVCQLLLRSRQTAVDA
RTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAVNNARAARSLLQGG
ADKDAQDSREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAGLAPADVARQRNHWDLLT
LLEGAGPLEARHKATPAREAGPSPRARMASGSVSPHGGGALPRCRTLSAGAGQRRGGACL
QARTSSVDLTARGGGAYSHCRSLSGGGVGGGPPPRGRRFSAGMRGPRPNPAIKRGRFGVA
AGCGGRVSADDWPCDWVALRPCGSASNIPIPPPCLTPSPERGSPQVDCGPPAHQEMPINP
GGEGKK
Download sequence
Identical sequences F7EN18
ENSCJAP00000003306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]