SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003606 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000003606
Domain Number - Region: 12-94
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000361
Family Dissimilatory sulfite reductase DsvD 0.086
Further Details:      
 
Domain Number - Region: 75-145
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003606   Gene: ENSCJAG00000001993   Transcript: ENSCJAT00000003799
Sequence length 205
Comment pep:novel chromosome:C_jacchus3.2.1:3:39098686:39149204:-1 gene:ENSCJAG00000001993 transcript:ENSCJAT00000003799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKKKGLSAEEKRTRMMEIFFETKDVFQLKDLEKIAPKEKGITSMSVKEVLQSLVDDSMV
DCERIGTSNYYWAFPSKALHARKRKLEALESQLSEGSQKHASLQKSIEKAKIGRCETEER
TMLAKELSSLRDQREQLKAEVEKYKDCDPQVVEEIRQVNKVAKEAANRWTDNIFAIKSWA
KRKFGFEENKIDKTFGIPEDFDYID
Download sequence
Identical sequences F7HA07
ENSCJAP00000003606 XP_002745430.1.60252 ENSCJAP00000003606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]