SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003616 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003616
Domain Number 1 Region: 52-225
Classification Level Classification E-value
Superfamily GAF domain-like 1.09e-38
Family GAF domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003616   Gene: ENSCJAG00000001990   Transcript: ENSCJAT00000003809
Sequence length 237
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:190298896:190360354:-1 gene:ENSCJAG00000001990 transcript:ENSCJAT00000003809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSEEQARSFLDQNPDFALQYFEKKLSPDNAATACEAGCPPGCASLRELFQVEESQALL
ELVQDMQENVNMERVVFKVLRRLCVLLQADRCSLFMYRQRNGVAELATRLFSVQPDSVLE
DCLVPPDSEIVFPLDVGVVGHVAQTKKMVNVKDVAECPHFSPFADELTEYETKNILAMPI
MNGKDVVAVIMAVNKLDGPCFTSEDEDVFSKYLNFATLNLKIYHLSYLHNCETRRGQ
Download sequence
Identical sequences F7H9Y8
ENSCJAP00000003616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]