SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003827 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000003827
Domain Number - Region: 30-142
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000396
Family G proteins 0.0087
Further Details:      
 
Domain Number - Region: 262-304
Classification Level Classification E-value
Superfamily Globin-like 0.0922
Family Globins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003827   Gene: ENSCJAG00000002113   Transcript: ENSCJAT00000004032
Sequence length 315
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:9617771:9681974:-1 gene:ENSCJAG00000002113 transcript:ENSCJAT00000004032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVPCALVTSCSSTFSGDRLVQHILGTEDLTVEVTSNDAVRFYPWTIDNKYYSADINL
CVVPNKFLVTAEIAESVQAFVVYFDSTQKSGLDSVSSWLPLAEAWLPEVMILVCDRVSED
GINRQKAQEWCIKHGFELVELSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDR
NQGFSLLNSLTGTNHSIGSADPCHSEQPHLPAAESTASLSDHLGGASNTADAQVDNLVDP
MLDLDIQELASLTTGGGDMENFERLFSKLKEMKDKAATLPHEQRKLHAEKVAKAFWMAIG
GDRDEIEGLSSDEEH
Download sequence
Identical sequences F7GZ31
XP_002753314.1.60252 ENSCJAP00000003827 ENSCJAP00000003818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]