SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003872 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003872
Domain Number 1 Region: 1769-2014
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.78e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 1095-1236
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000306
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 784-914
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000439
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 4 Region: 374-497
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000957
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 496-610
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 593-716
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000769
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 170-305
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000119
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 8 Region: 910-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000084
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 9 Region: 1066-1109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000144
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 10 Region: 144-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000025
Family EGF-type module 0.0027
Further Details:      
 
Domain Number 11 Region: 1328-1364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000025
Family EGF-type module 0.021
Further Details:      
 
Domain Number 12 Region: 721-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000304
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 13 Region: 908-1026
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000518
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 14 Region: 1457-1490
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0035
Further Details:      
 
Domain Number 15 Region: 297-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 16 Region: 339-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000339
Family EGF-type module 0.017
Further Details:      
 
Domain Number 17 Region: 107-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000355
Family EGF-type module 0.017
Further Details:      
 
Domain Number 18 Region: 28-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000429
Family EGF-type module 0.038
Further Details:      
 
Domain Number 19 Region: 1376-1408
Classification Level Classification E-value
Superfamily Notch domain 0.00000101
Family Notch domain 0.0014
Further Details:      
 
Domain Number 20 Region: 1038-1075
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000166
Family EGF-type module 0.024
Further Details:      
 
Domain Number 21 Region: 1416-1448
Classification Level Classification E-value
Superfamily Notch domain 0.00000209
Family Notch domain 0.0049
Further Details:      
 
Domain Number 22 Region: 759-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000138
Family EGF-type module 0.033
Further Details:      
 
Domain Number 23 Region: 66-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000175
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000003872
Domain Number - Region: 1234-1288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000213
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003872   Gene: ENSCJAG00000002121   Transcript: ENSCJAT00000004081
Sequence length 2311
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:14293812:14345582:-1 gene:ENSCJAG00000002121 transcript:ENSCJAT00000004081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPLPPLPVRALPLLLLLAGPGAAGPPCLDGSPCANGGRCTQLPSQEAACLCPPGWVGE
RCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARC
SVGPDGRFLCSCPPGYQGRSCRSDVDECRVGGPCRHGGTCLNTPGSFRCQCPAGYTGSLC
ENTIVPCAPSLCRNGGTCRQSGDFTYDCACLPGFEGQNCEVNVDDCPGHQCLNGGTCVDG
VNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQN
IDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGR
AICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNE
CLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFTCT
CPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPC
HHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDLVDKYLCRCPSGTTG
VNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVD
GENGFRCLCPPGSLPPLCLPPSHPCAHEPCNHGICYDAPGGFRCVCEPGWSGPRCSQSLA
RDACESQPCRAGGTCSSDGAGFHCTCPPGFQGRQCELLSPCTPNPCEHGGRCESAPGQLA
VCSCPQGWQGSRCQQDVDECASPSPCGPHGICTNLAGGFSCTCHGGYTGPSCDQNINDCD
PNPCLNGGLCQDGVGSFSCSCLPGFAGPRCAHDVDECLSSPCGPGTCTDHVASFTCTCPP
GYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQHEADPCLSRPCLHG
GICSAAHPGFRCTCPESFTGPQCQKLVDWCSREPCQNGGRCVQTGAYCLCPPGWSGRLCD
IRSLPCREAAAQIGVQPEQLCQAGGQCVDEDSSHYCVCPEGHTGSHCELEVDPCLAQPCQ
HGGTCRGYMGGYVCECLPGYNGDNCEDDVDECASQPCQHGGSCIDLVARYLCSCPPGTLG
VLCEINEDDCGPGPLLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGLRCEADINECRSGAC
HAAHTRDCLQDAGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQCRPSPGPGGGLTFT
CHCVQNPTPSLFGHRCERVARSCRELQCPVGVHASRHPAGRAALPPPGLSGSSCRSFSGS
PLGATNASCAAAPCLHGGSCRPAPLRPFFRCACTPGWTGPRCEAPAAAPEVPEEPRCPRV
ACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPA
CLYDNFDCHTGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLAR
GVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPDSELRAR
RELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVR
GEPLEPPEPSVPLLPLLAAGAVLLLVILVLGVMVARRKREHSTLWFPEGFALHKDVATGH
KGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEEAVDCRQW
TQHHLVAADIRMAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCGGALEPMPIEE
DEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLDAGADTNAQDH
SGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEGMVEELIASHA
DVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAAREGSYEAAKL
LLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLGPLLCPPGAFL
PGLKAAQSGAKKSRRPAGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLSPVDSLDSPRP
FGGPPASPGGFPLEGPYAAAAATAVSLAQLGGPGRAGLGRQPPGGCVLSLGLLNPVAVPL
DWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEEYPAAGAHSSP
PKARFLRVPSEHPYLTPSPESPDHWASPSPPSLSDWSESTPSPATATGAMATTTGALPSQ
PLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
Download sequence
Identical sequences F7GNR9
ENSCJAP00000003872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]