SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003877 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003877
Domain Number 1 Region: 1319-1564
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.79e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 37-167
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000612
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 341-471
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000973
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 4 Region: 652-793
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000126
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 150-273
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000604
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 8-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000839
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 7 Region: 623-666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000113
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 467-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000354
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 9 Region: 506-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000111
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 10 Region: 878-914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000196
Family EGF-type module 0.021
Further Details:      
 
Domain Number 11 Region: 278-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000232
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 12 Region: 544-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000529
Family EGF-type module 0.02
Further Details:      
 
Domain Number 13 Region: 1007-1040
Classification Level Classification E-value
Superfamily Notch domain 0.0000000615
Family Notch domain 0.0035
Further Details:      
 
Domain Number 14 Region: 926-958
Classification Level Classification E-value
Superfamily Notch domain 0.000000785
Family Notch domain 0.0014
Further Details:      
 
Domain Number 15 Region: 966-998
Classification Level Classification E-value
Superfamily Notch domain 0.0000017
Family Notch domain 0.0049
Further Details:      
 
Domain Number 16 Region: 594-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family EGF-type module 0.041
Further Details:      
 
Domain Number 17 Region: 316-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family EGF-type module 0.033
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000003877
Domain Number - Region: 791-840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000184
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003877   Gene: ENSCJAG00000002121   Transcript: ENSCJAT00000004086
Sequence length 1861
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:14293812:14345582:-1 gene:ENSCJAG00000002121 transcript:ENSCJAT00000004086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFTCTCPSGFSGSTCQLDVDECASTPCR
NGAKCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGT
RCESQVDECRSQPCRHGGKCLDLVDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDG
INRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSH
PCAHEPCNHGICYDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGAGFH
CTCPPGFQGRQCELLSPCTPNPCEHGGRCESAPGQLAVCSCPQGWQGSRCQQDVDECASP
SPCGPHGICTNLAGGFSCTCHGGYTGPSCDQNINDCDPNPCLNGGLCQDGVGSFSCSCLP
GFAGPRCAHDVDECLSSPCGPGTCTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGG
TCVDGVNSFSCLCRPGYTGAHCQHEADPCLSRPCLHGGICSAAHPGFRCTCPESFTGPQC
QKLVDWCSREPCQNGGRCVQTGAYCLCPPGWSGRLCDIRSLPCREAAAQIGVQPEQLCQA
GGQCVDEDSSHYCVCPEGHTGSHCELEVDPCLAQPCQHGGTCRGYMGGYVCECLPGYNGD
NCEDDVDECASQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPLLDSGPRCL
HNGTCVDLVGGFRCTCPPGYTGLRCEADINECRSGACHAAHTRDCLQDAGGGFRCLCHAG
FSGPRCQTVLSPCESQPCQHGGQCRPSPGPGGGLTFTCHCVQPFGHRCERVARSCRELQC
PVGPCQQTPRGPRCAPPGLSGSSCRSFSGSPLGATNASCAAAPCLHGGSCRPAPLRPFFR
CACTPGWTGPRCEAPAAAPEVPEEPRCPRVACQAKRGDQRCDRECNSPGCGWDGGDCSLS
VGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHTGGRERTCNPVYEKYCADHFA
DGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILR
TSLRFRLDAHGQAMVFPYHRPSPDSELRARRELAPEVIGSVVMLEIDNRLCLQSPENDHC
FPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPPEPSVPLLPLLAAGAVLLLVILVL
GVMVARRKREHSTLWFPEGFALHKDVATGHKGRREPVGQDALGMKNMAKGESLMGEVATD
WMDTECPEAKRLKVEEPGMGAEEAVDCRQWTQHHLVAADIRMAPAMALTPPQGDADADGM
DVNVRGPDGFTPLMLASFCGGALEPMPIEEDEADDTSASIISDLICQGAQLGARTDRTGE
TALHLAARYARADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLD
ARMADGSTALILAARLAVEGMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLK
NGANKDMQDSKEETPLFLAAREGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDI
VRLLDQPSGPRSPPGPHGLGPLLCPPGAFLPGLKAAQSGAKKSRRPAGKAGLGPQGPRGR
GKKLTLACPGPLADSSVTLSPVDSLDSPRPFGGPPASPGGFPLEGPYAAAAATAVSLAQL
GGPGRAGLGRQPPGGCVLSLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGT
PVSPQERPPPYLAVPGHGEEYPAAGAHSSPPKARFLRVPSEHPYLTPSPESPDHWASPSP
PSLSDWSESTPSPATATGAMATTTGALPSQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVL
A
Download sequence
Identical sequences F7GNQ0
ENSCJAP00000003877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]