SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003882 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003882
Domain Number 1 Region: 1776-2021
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.78e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 796-929
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000502
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 3 Region: 1107-1248
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000149
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 568-697
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000424
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 5 Region: 386-509
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000863
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 505-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000034
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 7 Region: 182-316
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000581
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 8 Region: 1078-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000144
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 9 Region: 156-193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000025
Family EGF-type module 0.0027
Further Details:      
 
Domain Number 10 Region: 922-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000321
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 11 Region: 960-998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000148
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 12 Region: 1335-1371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000025
Family EGF-type module 0.021
Further Details:      
 
Domain Number 13 Region: 999-1039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000639
Family EGF-type module 0.02
Further Details:      
 
Domain Number 14 Region: 1464-1497
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0035
Further Details:      
 
Domain Number 15 Region: 309-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 16 Region: 681-812
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000204
Family Growth factor receptor domain 0.0076
Further Details:      
 
Domain Number 17 Region: 351-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000339
Family EGF-type module 0.017
Further Details:      
 
Domain Number 18 Region: 119-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000399
Family EGF-type module 0.017
Further Details:      
 
Domain Number 19 Region: 40-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000411
Family EGF-type module 0.038
Further Details:      
 
Domain Number 20 Region: 1246-1296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000008
Family EGF-type module 0.016
Further Details:      
 
Domain Number 21 Region: 1383-1415
Classification Level Classification E-value
Superfamily Notch domain 0.00000101
Family Notch domain 0.0014
Further Details:      
 
Domain Number 22 Region: 1050-1087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family EGF-type module 0.024
Further Details:      
 
Domain Number 23 Region: 1423-1455
Classification Level Classification E-value
Superfamily Notch domain 0.00000209
Family Notch domain 0.0049
Further Details:      
 
Domain Number 24 Region: 78-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000019
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003882   Gene: ENSCJAG00000002121   Transcript: ENSCJAT00000004092
Sequence length 2318
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:14292815:14345582:-1 gene:ENSCJAG00000002121 transcript:ENSCJAT00000004092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGARGRCRRPMSPPLPPLPVRALPLLLLLAGPGAAGPPCLDGSPCANGGRCTQLPSQE
AACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDP
CLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGGPCRHGGTCLNTPGSFR
CQCPAGYTGSLCENTIVPCAPSLCRNGGTCRQSGDFTYDCACLPGFEGQNCEVNVDDCPG
HQCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCVC
VNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCHE
DAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRG
YTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGG
VCKDRVNGFTCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTLC
ERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDLVD
KYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINECA
SSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCNHGICYDAPGGFRCVCEP
GWSGPRCSQSLARDACESQPCRAGGTCSSDGAGFHCTCPPGFQGRQCELLSPCTPNPCEH
GGRCESAPGQLAVCSCPQGWQGSRCQQDVDECASPSPCGPHGICTNLAGGFSCTCHGGYT
GPSCDQNINDCDPNPCLNGGLCQDGVGSFSCSCLPGFAGPRCAHDVDECLSSPCGPGTCT
DHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQHE
ADPCLSRPCLHGGICSAAHPGFRCTCPESFTGPQCQKLVDWCSREPCQNGGRCVQTGAYC
LCPPGWSGRLCDIRSLPCREAAAQIGVQPEQLCQAGGQCVDEDSSHYCVCPEGHTGSHCE
LEVDPCLAQPCQHGGTCRGYMGGYVCECLPGYNGDNCEDDVDECASQPCQHGGSCIDLVA
RYLCSCPPGTLGVLCEINEDDCGPGPLLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGLRC
EADINECRSGACHAAHTRDCLQDAGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQCR
PSPGPGGGLTFTCHCVQSVWGHRCERVARSCRELQCPVGVHAQTPRGPRCAAPPGLSGSS
CRSFSGSPLGATNASCAAAPCLHGGSCRPAPLRPFFRCACTPGWTGPRCEAPAAAPEVPE
EPRCPRVACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCD
PACSSPACLYDNFDCHTGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASE
VPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSP
DSELRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFP
YPLRDVRGEPLEPPEPSVPLLPLLAAGAVLLLVILVLGVMVARRKREHSTLWFPEGFALH
KDVATGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEE
AVDCRQWTQHHLVAADIRMAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCGGAL
EPMPIEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLDAGA
DTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEGMVE
ELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAAREG
SYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLGPLL
CPPGAFLPGLKAAQSGAKKSRRPAGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLSPVD
SLDSPRPFGGPPASPGGFPLEGPYAAAAATAVSLAQLGGPGRAGLGRQPPGGCVLSLGLL
NPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEEYPA
AGAHSSPPKARFLRVPSEHPYLTPSPESPDHWASPSPPSLSDWSESTPSPATATGAMATT
TGALPSQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
Download sequence
Identical sequences F7GG85
ENSCJAP00000003872 ENSCJAP00000003882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]