SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004198 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004198
Domain Number 1 Region: 13-173
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-29
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 2 Region: 1438-1591
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-28
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 1049-1161
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 4 Region: 124-272
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-25
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 1241-1379
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 938-1052
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-22
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 7 Region: 572-716
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-21
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 8 Region: 800-941
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-20
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 233-377
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 10 Region: 450-607
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-17
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 11 Region: 1157-1273
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-16
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 12 Region: 1591-1666
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000143
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 13 Region: 721-827
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000128
Family Spectrin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004198   Gene: ENSCJAG00000002323   Transcript: ENSCJAT00000004426
Sequence length 1691
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:73843770:73909241:1 gene:ENSCJAG00000002323 transcript:ENSCJAT00000004426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQKEQVDPLQMKLQQVNGLGQGLIQSAGKDCDVQGLEHDMEEINARWNTLNKKVAQRIA
QLQEALLHCGKFQDALEPLLSWLADTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDR
KATVDMLQAEGGRIAQSAEVADREKITGQLESLESRWTELLSKAAARQKQLEDILVLAKQ
FHETAEPISDFLSVTEKKLANSEPVGTQTAKIQQQIIRHKALEEDIENHATDVHQAVKIG
QSLSSLTSAEQGVLSEKIDSLQARYREIQDRCCRKAALLDQALANARLFGEDEVEVLNWL
AEVEDKLSSVFVKDFKQDVLHKQHADHLALNEEIVNRKKNVDQAIKNGQALLKQTTGEEV
LLIQEKLDGIKTRYADITVTSSKALRTLEQARQLATKFQSTYEELTGWLREVEGELAANG
GQSPTGEQIPQFQQRQKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREGLDKLVSDAN
EQYKLVSDTIGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTA
QLQVQKAFSIDIIRHKDSMDELFSHRGEIFGTCGEEQKAVLQEKTESLIEQYEAISLLNS
DRYARLERAQVLVNQFWETYEELSPWIEETRTLIAQLPPPAIDHEQLRHQQEEMRQLRES
IAEHKPHIDKLLKIGPQLKELNPEEGKMVEEKYQNAENMYAQIKEEVRQRALALDEAVSQ
SAQITEFHDKIEPMLETLENLSSRLRMPPLIPAEVDKIRECISENKSATVELEKLQPSFE
ALKHRGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARAEEREIKFLDVLELAEKF
WYDMAALLTTIKDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGA
DLIFACGETEKPEVRKSIDEMNNAWENLNKTWKERLEKLEDAMQAAVQYQDTLQAMFDWL
DNTVIKLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETD
RDIIREPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQ
RPISGDPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLETM
NQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELTRMESQLSASKPTGGLPETAR
EQLDTHMELYSQLKAKEETYNQLLDKGRLMLLSRDDSGSGSKTEQSVALLEQKWHVVSSK
MEERKSKLEEALNLATEFQNSLQEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFA
NEVNAHRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDA
RKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYD
TTIRTGRALKEKTLLSEDTQKLDNFLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDA
LQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELI
ENSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEEFRDTVHMLLEWLSEAE
QTLRFRGALPDDTEALQTLIDTHKEFMKKVEEKRVDVNSAVAMGESSWLSATPTASQRSN
TGSPSSELALR
Download sequence
Identical sequences F7A7S6
ENSCJAP00000004198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]