SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004210 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004210
Domain Number 1 Region: 167-367
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.49e-53
Family Prokaryotic proteases 0.00000159
Further Details:      
 
Domain Number 2 Region: 379-473
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-18
Family HtrA-like serine proteases 0.0024
Further Details:      
 
Domain Number 3 Region: 39-119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000345
Family Growth factor receptor domain 0.0061
Further Details:      
 
Domain Number 4 Region: 103-152
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000173
Family Ovomucoid domain III-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004210   Gene: ENSCJAG00000002329   Transcript: ENSCJAT00000004438
Sequence length 476
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:36818767:36833810:1 gene:ENSCJAG00000002329 transcript:ENSCJAT00000004438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRPQLRPAGLGPCLLPGLLLLLVPVPWAGAKRLHAQLACPAVCQPTRCPALPRCALGTA
PVLDLCRCCRVCPAAEGEVCGGARGRPCAPGLQCLQSLGPWLPSTCGCPTLGAAVCGSDR
RTYPSLCALRANNRAARRRGEVPAVPVQWGDCRDTGTRSAGPLRSNYNFIAPVVEKVAPS
VVHLQLWRRLLPGSKPVPVYSGSGFIVSEDGLIITNAHVVMNQQGIEVELQSGAHYEAII
KDIDLKLDLAVIKIESNADLPVLLLGRSSDLRAGEFVVALGSPFSLQKTATAGIVSTTHR
GSKELGIENSDVDYIQTDAIVNQGNSGGPLVNLDGDVIGVNTLRMADGISFAVPSDRVRE
FLAEYHEHQLKGKAFSQKKYLGLQMLPLTMPLIQEMKMRDPAFPNVSSGVYVCKVIEGTS
AESSGLRGHDVIVNINGKPVTTTTDVVEALDSDSLSMVVLRGRSNLFLTVTPEIIN
Download sequence
Identical sequences F6YQ22
ENSCJAP00000004204 ENSCJAP00000004210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]