SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004325 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000004325
Domain Number - Region: 9-110
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0719
Family Spectrin repeat 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004325   Gene: ENSCJAG00000002387   Transcript: ENSCJAT00000004559
Sequence length 244
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:88701451:88726570:-1 gene:ENSCJAG00000002387 transcript:ENSCJAT00000004559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLKSFQIIAHLKHLQEEINEVKIWFNGITEKQDILNNNLTMLSQDIAKVEQSTTSMAK
DVGLKITTVKTDMRRISGLVTDVISLTDSVQELETKIEKVETSTVKNIGDLLSSSIDRTA
TLRKVASENSQRINSVKQTLTELKSDFDKHTDRFLSLESDRAKVLKTVTFANDLKPKVYN
LKKDFARLEPLVNDLTLRIGRLVTDLLQRGKEIAFLNEKISNLTIVQAEIKDIKDEIAHI
SDMN
Download sequence
Identical sequences F7CL04
ENSCJAP00000004325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]