SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004366 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000004366
Domain Number - Region: 50-105
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0228
Family Ribosomal protein S4 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004366   Gene: ENSCJAG00000002407   Transcript: ENSCJAT00000004602
Sequence length 258
Comment pep:novel chromosome:C_jacchus3.2.1:X:106638546:106639336:1 gene:ENSCJAG00000002407 transcript:ENSCJAT00000004602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHGPKKHLKQVAAPKHWMLDKLTGVFAPRPSTGPHLRECLPLIIFLRNRLKYALTGNEV
KKICMPWFIKIDGKVRTDITYAAGFMDVISIDKTGENFCLIYDTKGHFAVHRITPEEAKY
KLCKVVGTKGIPHLVTHDARTLRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVIG
DANLGRIGVITNRERHPGSFDMVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIR
LTIAEERDKRLAAKQSSG
Download sequence
Identical sequences F7BQC6
ENSCJAP00000004366 ENSCJAP00000004366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]