SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004544 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004544
Domain Number 1 Region: 62-294
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.18e-86
Family Calponin-homology domain, CH-domain 0.000000993
Further Details:      
 
Domain Number 2 Region: 4648-4807
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-29
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 3223-3383
Classification Level Classification E-value
Superfamily Spectrin repeat 6.52e-29
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 4 Region: 4254-4371
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 3334-3489
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-25
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 310-426
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-24
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 7 Region: 5160-5236
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.22e-23
Family GAS2 domain 0.00048
Further Details:      
 
Domain Number 8 Region: 2788-2945
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-22
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 9 Region: 4801-4917
Classification Level Classification E-value
Superfamily Spectrin repeat 4.44e-22
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 10 Region: 4451-4589
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 11 Region: 4148-4262
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-21
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 12 Region: 3782-3926
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-21
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 13 Region: 1900-2036
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-19
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 14 Region: 3443-3588
Classification Level Classification E-value
Superfamily Spectrin repeat 8.49e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 15 Region: 3551-3705
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-18
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 16 Region: 4036-4153
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-16
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 17 Region: 4336-4441
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-16
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 18 Region: 5071-5151
Classification Level Classification E-value
Superfamily EF-hand 7.05e-16
Family Polcalcin 0.057
Further Details:      
 
Domain Number 19 Region: 1225-1353,1380-1406
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000258
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 20 Region: 3002-3162
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000381
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 21 Region: 2679-2799
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000452
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 22 Region: 2455-2578
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000104
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 23 Region: 1765-1887
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000263
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 24 Region: 682-784
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000196
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 25 Region: 2225-2328
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000353
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 26 Region: 4925-4997,5025-5054
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000297
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 27 Region: 3707-3819
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000302
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 28 Region: 2010-2139
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000547
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 29 Region: 2363-2467
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000688
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 30 Region: 3931-4037
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000461
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 31 Region: 1502-1659
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000707
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 32 Region: 591-681
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000249
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 33 Region: 2110-2222
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000667
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 34 Region: 2587-2706
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000981
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 35 Region: 750-867
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000384
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 36 Region: 1425-1540
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000432
Family Spectrin repeat 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000004544
Domain Number - Region: 3137-3215
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00417
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004544   Gene: ENSCJAG00000002323   Transcript: ENSCJAT00000004791
Sequence length 5428
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:73498872:73910304:1 gene:ENSCJAG00000002323 transcript:ENSCJAT00000004791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSDEETLSERSCRSERSCRSERSYRSERSGSLSPCPPGDTLPWNLPLHEQKKRKSQDS
VLDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLS
GIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHF
QISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDL
VDMERVQIQSNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKV
PEGGEGISATEVDSRWQEYQSRVDSLIPWIKQHTILMSDKSFPQNPVELKALYNQYIHFK
ETEILAKEREKGRIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLR
PAVERLELLLQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQEC
EGLIRQLQVDLQILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPP
STLTTIHLKAEPLTKATHSSSTSWFRKPMTRAELVAISSSEDEGNLRFVYELLSWVEEMQ
MKLERAEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLYEGKMSQNFRTSYAETLGK
LETQYCKLKETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNPNISAKRN
YFSELTMELEEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQ
HMKENTAYFQFFSDARELESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIH
SKSSVASLVGRSKTIVQLKPRSPDHVLKSTISVKAICDYRQIEITICKNDECVLEDNSQR
TKWKVISPTGNEAMVPSVCFLIPPPNKDAIEMASRVEQSYQKVMALWHQLHVNTKSLISW
NYLRKDLDLIQTWNLEKLRSSAPGECQQIMKNLQGHFEDFLQDSRDSVLFSVADRLRLEE
EVEACKARFQHLMKSMENEDKEETVAKMYISELKNIRLRLEEYEQRVIKRIQSLASSRTD
KDAREDNALRIAEQEHTQEDLQQLRSDLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVE
KMDHVYGLSTVYLNKLKTIDVIVRSIQDAELLVKGYEIKLSQEEAVPADLSALEAHRSTL
RHWLSDVKDKNSVFSVLDEEIAKAKAVVEQMSRLTSERNLDLERYQEKGSQLQERWHRVI
AQLEIRQSELEGIQEVLGDYRTCHGTLIKWIEATTTQQEMMKPGQAEDSRVLSEQLSQQT
DLFAEIERNQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDA
ITQEFMDLRTRYTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQAHVEKVKELLGWVSS
LARNTQGKATSSQIKESTDIEKAILEQQVLAEELTTKREQVSEAIKTSQIFLAKHGHKLS
EKEKEQISDQLNALNKTYHDLCDGSANQLQQLQSQLAHQTEQKTLQKQRNTCHQKLEDLC
SWVGQAERALAGHQGRTTQQDLSALQKNQSDLKDLQDDIQNHVTSFATVVKDIEGFMEEN
QTKLSPYELTALREKLHQAKEQYEALQEQTRVAQKELEEAVTSVLQQETEKSKAAKELAE
NKKKIDALLEWVTSVGSSDGQLLTNLPGMEQFSGASLEKGALDTTDGYMGVNQAPEKLDK
QCEKMKARHRELLSQQQNFILATQSAQAFLDQHGYNLTPEEQQMLQEKLGELKEQYSTSL
TQSEAELKRMQTLQDELQKFLQDHREFESWLERSEKELENMHKGGSSPKALPSLLKRQGS
FSEDVISHKGDLRFVTISGQKVLDTENSFKEGKEPSEIGNLVRDKLQDATERYTALHSKC
TRLGSHLNMLLGQYHQFQNSADSLQAWMQTCEANVEKLLSDTVASDPGVLQEQLATTKQL
QEELAEHQVPVEKLQKVARDIMEIEGEPAPDHKHVQETTDSIFSHFQSLSYSLAERSALL
QKAIAQSQSVQESLETLLQSIGEVEQNLEGNQVASLSSGVIQEALATNMKLKQDIARQKS
SLEATREMVTRFMETADGTTAAVLQGKLAEVSQRFEQLCLQQQEKESSLKKLLPQAEMFE
HLSDKLQQFMENKSRMLASGNQPDQDIAHFFQQIQELSLEMEDQQENLDTLEHLVTELSS
CGFALDLSQHQDRVQNLRKDFTELQKTVKEREKDASSCQEQLDEFRKLVRTFQKWLKETE
GSIPPTETSMSAKELEKQIEYLKSLLDDWASKGTLVEEINCKGTSLENLIMEITAPDSQG
KTGSILPSVGSSVGSVNGYHTCKDLTEIQCDMSDVNLKYEKLGGVLHESQESLQAVLNKM
EEVQKEANSVLQWLESKEKVLKSMDAMSSPTKTETVKAQAESNKAFLAELEQNSPKIQKV
KEALAGLLVTYPNSQEAENWKKIQEELNYRWERATELTVARQRQLEESASHLAYFQAAES
QLRPWLMEKELMMGVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLNEAAQGILMG
PGDVSLSTSQVQKELQSINQKWVELTDKLNSRSSQIDQAIVKSTQYQELLQDLSEKVKTV
GQRLSGQSAISTQPEAVKQQLEETSEIRSDLEQLDQEVKEAQTLCDELSVLIGEQYLKDE
LKKRLETVALPLQGLEDLAADRMNRLQAALASTQQFQQMFDELRTWLDDKQSQQTKNCPI
SAKLERLQSQLQENEEFQKSLNQHSGSYEVIVAEGESLLLSVPPGEEKRTLQNQLVELKN
HWEELSKKTADRQSRLKDCMQKAQKYQWHVEDLVPWVEDCKAKMSELRVTLDPVQLESSL
LRSKAMLSEVEKRRSLLEILNSAADILINSSEADEDGIRDEKAGINQNMDAITEELQAKT
GSLEEMTQRLKEFQESFKNIEKKVEGAKHQLEIFDALGSQACSNKNLEKLRAQQEVLQAL
EPQVDYLRNFTQGLVEDAPDGSDASQLLHQAEVAQQEFLEVKQRVNSGCVMMENKLEGIG
QFHCRVREMFSQLADLDDELDGMGAVGRDTDSLQSQIEDVRLFLNKIQVLKLDIEASEVE
CRHMLEEEGTLDLLGLKRELEALNKQCGKLTERGKARQEQLELTLGRVEEFYRKLKGLND
ATTGAEEAEALQWVVGTEVEIINQQLADFKMFQKEQVDPLQMKLQQVNGLGQGLIQSAGK
DCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLADTEELI
ANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSAEVADREKITGQL
ESLESRWTELLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTA
KIQQQIIRHKALEEDIENHATDVHQAVKIGQSLSSLTSAEQGVLSEKIDSLQARYREIQD
RCCRKAALLDQALANARLFGEDEVEVLNWLAEVEDKLSSVFVKDFKQDVLHKQHADHLAL
NEEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTLEQ
ARQLATKFQSTYEELTGWLREVEGELAANGGQSPTGEQIPQFQQRQKELKKEVMEHRLVL
DTVNEVSRALLELVPWRAREGLDKLVSDANEQYKLVSDTIGQRVDEIDAAIQRSQQYEQA
ADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRGEIF
GTCGEEQKAVLQEKTESLIEQYEAISLLNSDRYARLERAQVLVNQFWETYEELSPWIEET
RTLIAQLPPPAIDHEQLRHQQEEMRQLRESIAEHKPHIDKLLKIGPQLKELNPEEGKMVE
EKYQNAENMYAQIKEEVRQRALALDEAVSQSAQITEFHDKIEPMLETLENLSSRLRMPPL
IPAEVDKIRECISENKSATVELEKLQPSFEALKHRGEELIGRSQGADKDLAAKEIQDKLD
QMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPSI
IKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGETEKPEVRKSIDEMNNAWENLNK
TWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEF
KVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKLE
GALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQAT
VETVNKAGNELLESSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQAQGFHS
EIEDFLLELTRMESQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRLM
LLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKLEEALNLATEFQNSLQEFINWLT
LAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDVV
LIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELE
ISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLSEDTQKLDNFLGEVR
DKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMN
LMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSVS
KQSRLEQALKQAEEFRDTVHMLLEWLSEAEQTLRFRGALPDDTEALQTLIDTHKEFMKKV
EEKRVDVNSAVAMGEILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSEL
VANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVDRV
TKTYKRKNIEPTHAPFIEKSRSGGRKSLSQPTPPPMPILSQSEAKNPRINQLSARWQQVW
LLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGK
ITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDAD
KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDE
FLVKNDPCRARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQ
SNHSCTSMPSSPATPASGTKVIPSSGSKLKRPTPTFHSSRTSLAGDTSNSSSPASTGAKT
NRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQGNSR
RGLNKPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences F7C4Z4
ENSCJAP00000004544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]