SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004656 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004656
Domain Number 1 Region: 2-50
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000183
Family HLH, helix-loop-helix DNA-binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 58-110
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000222
Family Hairy Orange domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004656   Gene: ENSCJAG00000002556   Transcript: ENSCJAT00000004912
Sequence length 279
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:74057578:74066552:-1 gene:ENSCJAG00000002556 transcript:ENSCJAT00000004912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIEKRRRDRINSSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDA
RALAVDFRSIGFRECLTEVIRYLGVLEGPSSRADPVRIRLLSHLNSYAAEMEPSPTPTGP
LAFPAWPWSFFHSCPGLPALSNQLTILGRVPGPVLPGASSPAYPIPALRTAPIRRATGII
LPARRNLLPSRGASSTRRARPLERPAAPVPVAPSSRAARSSHITPLLRSSSPTPSGPAGS
AAYVAVPTPNSSSPGPAGRPAGAMLYHSWVSEITEVGAF
Download sequence
Identical sequences F6Y183
ENSCJAP00000004656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]