SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004715 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004715
Domain Number 1 Region: 226-295
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000004715
Domain Number - Region: 285-374
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.0382
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004715   Gene: ENSCJAG00000004199   Transcript: ENSCJAT00000004974
Sequence length 473
Comment pep:known chromosome:C_jacchus3.2.1:4:42908494:42964148:-1 gene:ENSCJAG00000004199 transcript:ENSCJAT00000004974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQLGGPPTPAINTPVHFQSPP
PVPGEVLKVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASP
GVRAGHVLSSSAGNSAPNSPMAMLHIGSNPEREFDDVIDNIMRLDDVLGYINPEMQMPNT
LPLSSSHLNVYSSDPQVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNHNLI
ERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSR
RLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEALMLG
AEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPEHGS
PFPGLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL
Download sequence
Identical sequences A0A2K5SBX6 B0KWN0
XP_008992661.1.60252 ENSCJAP00000004715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]