SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004933 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004933
Domain Number 1 Region: 230-334
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.97e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 88-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000458
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.054
Further Details:      
 
Domain Number 3 Region: 5-52
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000903
Family HLH, helix-loop-helix DNA-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004933   Gene: ENSCJAG00000002704   Transcript: ENSCJAT00000005200
Sequence length 597
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:21:40687192:40740074:1 gene:ENSCJAG00000002704 transcript:ENSCJAT00000005200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGL
GDAWGQPSRTGPLDSVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPSDHDEMTAVLTAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGY
KVIHCSGYLKIRQFMLDMALYDSCYQIVGLVAVGQSLPPSAITEIKLHSNMFMFRASLDL
KLIFLDSRVTEVTGYEPQDLIEKTLYHHVHGCDVFHLRYAHHLLLVKGQVTTKYYRLLSK
RGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTEIEYKELQLSLEQVSTKSQDSWRTALS
TSQESRNNEPKKNTKMKTKLRTNPYPPQQYSSFQMDKLECGQLGNWRASPPASTPAPPEP
QLHSESSDLLYAPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFLS
TLPASGECQWHYANPLVPSSSSPAKNPPEPPVNTARHSLMPSYEVPSAAMRTFTEDTAAP
ELPEAHYREEPTLGPVKDARLSGSGLVLACAASECCSLPVLEPPGAQEHLPFVLINY
Download sequence
Identical sequences F6UE44
ENSCJAP00000004933 ENSCJAP00000002674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]