SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005057 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005057
Domain Number 1 Region: 43-238
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 1.18e-75
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000127
Further Details:      
 
Domain Number 2 Region: 319-475
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 7.85e-66
Family C-terminal domain of adenylylcyclase associated protein 0.0000000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005057   Gene: ENSCJAG00000002738   Transcript: ENSCJAT00000005328
Sequence length 475
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:74524305:74603263:1 gene:ENSCJAG00000002738 transcript:ENSCJAT00000005328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMQNLVERLERAVGRLEAVSHTSDMHRGYGDNPSKAGAAPYVQAFDLLLAGPGAEYLK
ISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPADNKLSDLLAPISEQIKEVITFRE
KNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHV
DWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPPPGPPPP
PVSTSSGSDESASRSALFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPF
SAPKPQTSPSPKPATKKEPAVLELEGKKWRVENQENVSNLVIDDTELKQVAYIYKCVNTT
LQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHAYL
SKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
Download sequence
Identical sequences F7HYM6
XP_002750694.2.60252 XP_008999207.1.60252 XP_008999208.1.60252 XP_008999209.1.60252 ENSCJAP00000005057 ENSCJAP00000005040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]