SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005329 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005329
Domain Number 1 Region: 67-375
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-84
Family Transglutaminase core 0.000000748
Further Details:      
 
Domain Number 2 Region: 395-507
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.59e-28
Family Transglutaminase, two C-terminal domains 0.0023
Further Details:      
 
Domain Number 3 Region: 509-607
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.62e-27
Family Transglutaminase, two C-terminal domains 0.00077
Further Details:      
 
Domain Number 4 Region: 3-68
Classification Level Classification E-value
Superfamily E set domains 0.000000000000206
Family Transglutaminase N-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005329   Gene: ENSCJAG00000037326   Transcript: ENSCJAT00000005623
Sequence length 613
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:20326409:20348640:-1 gene:ENSCJAG00000037326 transcript:ENSCJAT00000005623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQALGIKSCDFQVARNNEEHHTKALSSRRLFVRRGQPFTITLHFRAPVHAFLPALKKVA
LTAQTDDAVFLNNEAQRREYLLNQNGLIYLGTADCIQAESWDFGQFEGDVIDLSLRLLNE
DKQVEKWSQPVHVASVLGAWLHALKEKRVLPTPQTQATQEGPSLNKRRGSVPILRQWLTG
QGRPVYDGQAWVLAAVACTVLRCLGIPARVVTTFASAQGTGGRLLVDEYYNEEGLQNGEG
QRGRIWIFQTSTECWMTRPALPQGYDGWQILHPSAPNGGRVLGSCELVPVRAVKEGMLGL
TPAVSDLFAAINASCVVWKCREDGKLELTDSNTKYVGNNISTKGVGSDRCEDITQNYKYP
EGSLQEKEVLERVKKERMKFGKDNGICPPSLETANPLYLFLKAPSSLPLRGDGQISVTLI
NHSEQEKAVQLAIGVQAVHYNGVLAAELWRKKLSLTLSDNLEKTITIGLFFSNFEQNVPE
NTFLRLTAMAAYSESSLSCFAQEDIAICKPHLAIKMPEKAEQYQPLTASVNIQNSLDAPM
KHCVISILGRGLIHRERSYRFGSVWPENTMCTQFQFTPTHLGLQRLTVEVDCNMFQNLTN
YKSVTVVAPTLSA
Download sequence
Identical sequences F7ILV1
ENSCJAP00000005329 ENSCJAP00000005329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]