SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005345 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005345
Domain Number 1 Region: 147-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.21e-129
Family Transglutaminase core 0.00000000706
Further Details:      
 
Domain Number 2 Region: 3-146
Classification Level Classification E-value
Superfamily E set domains 3.85e-42
Family Transglutaminase N-terminal domain 0.00017
Further Details:      
 
Domain Number 3 Region: 618-716
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.94e-27
Family Transglutaminase, two C-terminal domains 0.00027
Further Details:      
 
Domain Number 4 Region: 505-616
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.66e-25
Family Transglutaminase, two C-terminal domains 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005345   Gene: ENSCJAG00000032332   Transcript: ENSCJAT00000005639
Sequence length 719
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:20363658:20403420:-1 gene:ENSCJAG00000032332 transcript:ENSCJAT00000005639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGLEVALTDLQSSRNNVQHHTEEITVDHLLVRRGQAFNLTLYFRNRGFQPGRDNIIFV
VETGPLPDLALGTRAVFSLASHGSPSPWIAWLETNGDTSTEVSLCAPPTAAVGRYLLKIH
VDSFHGSVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGNKNWIHPCP
WNYGQFEEKIIDICLQLLDKSLHFQTDPATDCALRGSPIYVSRVVCAMINSNDDNGVLNG
NWSENYTDGANPVEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILGNKKDTIWNFHVWNECWMARKDLPPGYGGWQVLDA
TPQETSNGLYCCGPASVRAIKEGEVDLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQDTS
SVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKARRFHGSQRGAELQPS
RPTPLSQDSPRSLDVPSLRPSDVVQVSLKFKMLDPPNMGWDISFALLALNMSSQFKDLKV
NLSAQSLLHDGNPLPPFWQDVAFITLSPQEAKAYPCKISYSQYSQYLSTDKLIRISALGE
EKSNPKKILVNKIITLSYPSIMINVLGAAIVNQPLSIQVIFSNPLSEHVEGCVLTVEGSG
LFKKQQKILLGVLKPQHRASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Download sequence
Identical sequences F7IJJ3
ENSCJAP00000005345 ENSCJAP00000005345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]