SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005350 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005350
Domain Number 1 Region: 62-377
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.58e-129
Family Transglutaminase core 0.00000000706
Further Details:      
 
Domain Number 2 Region: 533-631
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.37e-27
Family Transglutaminase, two C-terminal domains 0.00027
Further Details:      
 
Domain Number 3 Region: 420-531
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.51e-25
Family Transglutaminase, two C-terminal domains 0.00036
Further Details:      
 
Domain Number 4 Region: 2-60
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000346
Family Transglutaminase N-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005350   Gene: ENSCJAG00000032332   Transcript: ENSCJAT00000005644
Sequence length 634
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:20363765:20397542:-1 gene:ENSCJAG00000032332 transcript:ENSCJAT00000005644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLEVALTDLQSSRNNVQHHTEEITVDHLLVRRGQAFNLTLYFRNRGFQPGRDNIIFVVET
EDAVYLDSEPQRQEYVMNDYGFIYQGNKNWIHPCPWNYGQFEEKIIDICLQLLDKSLHFQ
TDPATDCALRGSPIYVSRVVCAMINSNDDNGVLNGNWSENYTDGANPVEWTGSVAILKQW
HATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVITNFDSGHDTDGNLIIDEYYDNTGRIL
GNKKDTIWNFHVWNECWMARKDLPPGYGGWQVLDATPQETSNGLYCCGPASVRAIKEGEV
DLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQDTSSVGNFISTKSIQSDERDDITENYKY
EEGSLQERQVFLKALQKLKARRFHGSQRGAELQPSRPTPLSQDSPRSLDVPSLRPSDVVQ
VSLKFKMLDPPNMGWDISFALLALNMSSQFKDLKVNLSAQSLLHDGNPLPPFWQDVAFIT
LSPQEAKAYPCKISYSQYSQYLSTDKLIRISALGEEKSNPKKILVNKIITLSYPSIMINV
LGAAIVNQPLSIQVIFSNPLSEHVEGCVLTVEGSGLFKKQQKILLGVLKPQHRASIILET
VPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Download sequence
Identical sequences F7IH92
ENSCJAP00000005350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]