SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005732 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005732
Domain Number 1 Region: 50-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-32
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 170-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-18
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 3 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005732   Gene: ENSCJAG00000003126   Transcript: ENSCJAT00000006040
Sequence length 533
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:110318659:110438849:-1 gene:ENSCJAG00000003126 transcript:ENSCJAT00000006040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHGRSVLHIVASLIILHLSGATKKGTEKQTTSETQKSMQCGTWTKHAEGGIFTSPNYPS
KYPPDRECIYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQ
QNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGALKPLPVCEFEMGGPE
GIVESIQIMKEGKATASEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCIVIILIIIS
VIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGATADFADVADDFENYHKL
RRSSSKCIHDHHCGSQLSSTKGSRSNLSTRDASILTEMPTQPGKPLIPPMNRRNILVMKH
NYSQDAADACDIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences A0A2K6V6G2 F7IEI1
XP_002757374.1.60252 XP_003926043.1.74449 XP_008978226.1.60252 XP_010335027.1.74449 ENSCJAP00000005722 ENSCJAP00000005723 ENSCJAP00000005732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]