SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005773 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005773
Domain Number 1 Region: 535-564,661-740
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000131
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005773   Gene: ENSCJAG00000003142   Transcript: ENSCJAT00000006081
Sequence length 757
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:24315244:24323982:-1 gene:ENSCJAG00000003142 transcript:ENSCJAT00000006081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGLEKSGRPRDMQALLPATRAMELRKQDYHMERPLLNQEHLEELGHWGSAPRTRQWRTWL
QCSRARAHALLLQRLPILVWLPRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLAPQALNDSTINETARDAAR
VQVASTLSVLVGLFQVGLGLHFGFVGHLPVRASRPEGYTTAAAVQVFVSQLQVCVLSSIA
SHSGQLSLIYTVLEVCWKLPDSKVGTMVTAAVAGVVLVLVKLLNDKLQQQLPMPIPGELL
TLIGATSISYGMDLKHRFKVSVVGNIPTGLVSPVAPNAQLFSKLMGSAFTIALVGFAIAI
SLGKIFALRHSYRVDSNQELVALGLSNLIGGIFRCFPVSCSMSRSLVQESTGGNSQVAGA
VSSFFILLIIVKLGELFHDLPKAVLAAIVIVNLKGMLRQLSDICSLWKANRADLLIWLVT
FIATILLNLDLGLVAAVIFSLLLVVVRTQRPHYSILGQVPDTDIYRDVAEYSEAKEVPGV
KVFRSSATVYFANAEFYSDALKQRCGVDVDLLISQKKKLLKKQEQLKLKQLQKEKKLQKQ
ATSSKDTSVSINVNTSLEDMSNNVEDCKVMVSPGDKMEDATASGQEDSKAPDVSTLKALG
LPQPDFHSLILDLSALSFVDTVCLKSLKNIFRDFREIEVEVYMAACHSPVVSQLEAGHFF
DASVTKKHLFASVHDAVTFALQHPRPVTDSPVSVTRL
Download sequence
Identical sequences F7I9U6
ENSCJAP00000005773 ENSCJAP00000005785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]