SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005864 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005864
Domain Number 1 Region: 494-815
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.92e-109
Family PDEase 0.000000000012
Further Details:      
 
Domain Number 2 Region: 105-299
Classification Level Classification E-value
Superfamily GAF domain-like 1.61e-44
Family GAF domain 0.00008
Further Details:      
 
Domain Number 3 Region: 285-489
Classification Level Classification E-value
Superfamily GAF domain-like 1.74e-37
Family GAF domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005864   Gene: ENSCJAG00000003176   Transcript: ENSCJAT00000006176
Sequence length 833
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:74388909:74518067:1 gene:ENSCJAG00000003176 transcript:ENSCJAT00000006176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPFGDKTREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKIS
ASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSH
LDVTALCHKIFLHIHGLISADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEASNNCIR
LEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVA
QAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFE
EQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDALTREH
DANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKN
KVIGVCQLVNKMEENTGKVKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVT
LEVLSYHASAAEEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDL
NLVQNFQMKHEVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLE
ILALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILS
GLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKDLFLAMLMTA
CDLSAITKPWPIQQRIAELVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFID
AICLQLYEALTHVSEDCFPLLDGCRKNRQKWQALAEQQEKMLINGESGQAKRN
Download sequence
Identical sequences A0A2K6SYR1 F7HR58
ENSCJAP00000005864 XP_002806697.2.60252 XP_010338647.1.74449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]