SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005870 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000005870
Domain Number - Region: 143-183
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00497
Family Frizzled cysteine-rich domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005870   Gene: ENSCJAG00000003215   Transcript: ENSCJAT00000006182
Sequence length 449
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:8930391:9527181:1 gene:ENSCJAG00000003215 transcript:ENSCJAT00000006182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWA
RLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQITRSFIAARTFVQGLT
VGREVANRVSKLSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDT
EWNLFIGKKCLNRSENSSIFWASSIVSVISVKISERILKKTKNSLQVSIKVFQGCGQPKP
APALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTI
CKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMA
LRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRRE
VDSSAAQRGHSLLSCSLACTVLALQRLCR
Download sequence
Identical sequences F7HKQ9
ENSCJAP00000005870 ENSCJAP00000005870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]