SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005968 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005968
Domain Number 1 Region: 254-395
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.33e-35
Family cAMP-binding domain 0.00000195
Further Details:      
 
Domain Number 2 Region: 120-250
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-32
Family cAMP-binding domain 0.000000927
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005968   Gene: ENSCJAG00000003255   Transcript: ENSCJAT00000006290
Sequence length 404
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:24429318:24527615:-1 gene:ENSCJAG00000003255 transcript:ENSCJAT00000006290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVKFAVDYFTRLREARAPASVLPDATPRQSLG
HTTPEPGPDHVADANGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIH
PKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIE
RGTYDILVTKNNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRI
IVKNNAKKRKMFESFIESVPLLKSLELSERMKIVDVIGEKIYKDGERIITQGEKADSFYI
IESGEVSILIRSKTKSNKDGGNQEVEITRCHKGQYFGELALVTNKPRAASAYAVGDVKCL
VMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSMDLGNLGQ
Download sequence
Identical sequences F7IC18
XP_003734888.1.60252 ENSCJAP00000005954 ENSCJAP00000005957 ENSCJAP00000005968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]