SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006155 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006155
Domain Number 1 Region: 483-586
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000491
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006155   Gene: ENSCJAG00000003372   Transcript: ENSCJAT00000006495
Sequence length 611
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:129541405:129564828:1 gene:ENSCJAG00000003372 transcript:ENSCJAT00000006495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPASPAPPKKMLGQARFSSPGMAPNTCCCSPAALQRKLPILAWLPNYSLQWLKMDFIAG
LSVGLTVIPQALAYAEVAGLPPQYGLYSAFTGCFVYFFLGTSRDVTLGPTAIMSLLVSFY
TFHEPAYAVLLAFLSGCIQLVMGVLRLGFLLDFISCPVIKGFTSAATVTIGFGQIKNLLG
LQNIPRQFFLQVYHTFLRIEETRVGDAILGLVCMVLLLVLKLMRDHMPPVHPEMPSGVRL
SHSLVWAATTARNALVVSFSALVAYSFEVTGYQPFILTGETAEGLPSVWIPPFSMTTANR
TISFAEMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAMGLTNVLGSLV
SSYPVTGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAV
APLFDTKIFGTLWRVKRLDLLPLCVTFLLSFWEMQYGILAGALVSLLMLLHSAARPKTKV
SEGPVLVLQPASGLHFPAVEALREEILSQALEVSPPRCLVLECTHVCSIDYTVVLGLGEL
LEDFHKQGVALAFVGLQVPILRVLLSADLKGFQYFSTLEEAEKYLRQEPGTQPYNSREDS
APEHKITLLQA
Download sequence
Identical sequences F7EDM8
XP_008996117.1.60252 XP_008996118.1.60252 XP_017828402.1.60252 ENSCJAP00000006155 ENSCJAP00000006155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]