SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006501 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006501
Domain Number 1 Region: 337-571
Classification Level Classification E-value
Superfamily Caspase-like 1.05e-38
Family Caspase catalytic domain 0.016
Further Details:      
 
Domain Number 2 Region: 25-126
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-22
Family DEATH domain, DD 0.0062
Further Details:      
 
Domain Number 3 Region: 128-214
Classification Level Classification E-value
Superfamily Immunoglobulin 9.59e-16
Family I set domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006501   Gene: ENSCJAG00000003580   Transcript: ENSCJAT00000006865
Sequence length 832
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:96564963:96638090:1 gene:ENSCJAG00000003580 transcript:ENSCJAT00000006865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPGDPLQAPPTPATPAGPPLPPPACATLNRLREPLLRRLSERLDRAPEGRGWRRLAEL
AGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSEFLQAMAHTDVLQ
LLSPPVGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNA
VHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDVPESFQRKKNGIYKNHKVVLEVCSLPRRK
NSHIVVLLLTFQFFSIIERIPHALFFLKHVPIERITSLSFSLPPQDLIHEIFYWHFCFIF
STNDFVESRSDRCTYTKSSHTPEIASSESNSCVLIFVSSLNILFFPKAKDKVALLIGNMN
YWEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYY
AGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDD
TIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEEKKITVLLDEV
AEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCL
KFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPE
ETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLI
AKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGIYHSHPSNPSNVT
PADSCHCSRTPDAFISSFAHHSSCHFSRSNVPVETTDEIPFSFSDRLRISEK
Download sequence
Identical sequences F7FHG4
ENSCJAP00000006501 ENSCJAP00000006501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]