SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006597 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006597
Domain Number 1 Region: 6-273
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-69
Family Inorganic pyrophosphatase 0.000000978
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006597   Gene: ENSCJAG00000003636   Transcript: ENSCJAT00000006963
Sequence length 277
Comment pep:novel chromosome:C_jacchus3.2.1:17:48795926:48797618:-1 gene:ENSCJAG00000003636 transcript:ENSCJAT00000006963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILGFEVHESAAPFSLEYEALLKNEKIQYISPLLVIPIFAGKDEFHMVVEVPDWSNAKLQI
ATNDPLNPIKQYVNKGNFHYVANLFPYKGYIWNCGAIPHTWKDSGHNDKPTGCCGDNGPI
DCARGEIIGVKVLGILAMIEEGEPDWKVIAINVNDADAANYNDINDVKQLKGYLEATVDC
FRKYELPDGKPENEFAFNAEFKDKFAIYIKSTHDHWKALVSKKNGKGIHCMNTTVSERPF
KCDPNAARAIVDALPPPCESACTLPTKVDKWFYRQKN
Download sequence
Identical sequences F7DH82
ENSCJAP00000006597 ENSCJAP00000006597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]