SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006690 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006690
Domain Number 1 Region: 25-138
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.35e-47
Family MHC antigen-recognition domain 0.00000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006690   Gene: ENSCJAG00000035293   Transcript: ENSCJAT00000007063
Sequence length 154
Comment pep:novel scaffold:C_jacchus3.2.1:GL285019.1:119403:122297:-1 gene:ENSCJAG00000035293 transcript:ENSCJAT00000007063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGIMAPRTLLLLLSAAMALTETWAGSHSLRYFQTAVSRSGSREPHFFAVGYVDDTQFERF
DSDAAIPRGEPRTPWMELEGPEYWDLQTRTLKARAQTNQVCLRTLRGYYNQSEAGSHTYQ
RMYGCDLGPDGRLLRGYRLRSPSASSRRPMRRRR
Download sequence
Identical sequences H9KW17
ENSCJAP00000006690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]