SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006959 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006959
Domain Number 1 Region: 65-121,148-399
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.44e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000175
Further Details:      
 
Domain Number 2 Region: 408-521
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.58e-36
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000597
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006959   Gene: ENSCJAG00000012407   Transcript: ENSCJAT00000007356
Sequence length 522
Comment pep:known chromosome:C_jacchus3.2.1:13:28635150:28699810:-1 gene:ENSCJAG00000012407 transcript:ENSCJAT00000007356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLPRALSSGGRPSWRRAARASRGFPLPPPFPAAATHALSRVMACRQEPQPQGPPPSAG
AVVSYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFLHDHGDYGFSSCEGKFNWRVIKEKRDTYVSRLNTIYQNNLTKAHIEIIHGHAVFTSDT
KPTIEVSGRKYTAPHILIATGGMPSSPHESQIPGASLGITSDGFFELEELPSRSVIVGAG
YIAVEIAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKK
TSSGLEVSLVTAVPGRLPVMTTISDVDCLLWAIGRDPNSKGLSLNKLGIKTDDKGHIIVD
EFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFENKEDSKLDYNNIPTVVFSHPP
IGTVGLTEDEAIHKYGKENVKIYSTSFTPMYHAVTKRKTKCVMKMVCAYEEEKVVGIHMQ
GLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Download sequence
Identical sequences F7H0C5
ENSCJAP00000006959 ENSCJAP00000006959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]