SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007089 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007089
Domain Number 1 Region: 19-76
Classification Level Classification E-value
Superfamily GLA-domain 1.43e-21
Family GLA-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007089   Gene: ENSCJAG00000003895   Transcript: ENSCJAT00000007488
Sequence length 231
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:138635344:138638946:1 gene:ENSCJAG00000003895 transcript:ENSCJAT00000007488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVFLEAKDAHSVLKRFPRANEFLEELRQGTIERECMEEICSYEEVKEVFENKEKTMEFW
KGYPNAVYSVRDPSQSSDAMYVVVPLLGVALLIVIALFIIWRCQLQKATRHHPSYAQNRY
LASRAGHSLPRVMVYRGTVTSQGEPSGHREAGSSPQVVLGPSRGGRTTVRLESTLYLPEL
SLSRLSSATPPPSYEEVTAPQDSSSEETSVSYSDPPPKYEEIVATNPGADK
Download sequence
Identical sequences F6TGP9
ENSCJAP00000007089 ENSCJAP00000007083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]